PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g07270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27003.5 Da    PI: 9.0494
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g07270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.7e-18114168256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tk q   Lee F+++++++ +++++LA++l++  rqV vWFqNrRa+ k
  CA02g07270 114 RKKLRLTKVQSALLEESFKQQSTLNPKQKQHLARRLNVRPRQVEVWFQNRRARTK 168
                 678899***********************************************98 PP

2HD-ZIP_I/II115.92.3e-37114202190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl+k q++lLEesF+++++L+p++K++lar+L+++prqv+vWFqnrRARtk+kq+E+dye+Lk+++ +l++en++L ke +eL+ +
   CA02g07270 114 RKKLRLTKVQSALLEESFKQQSTLNPKQKQHLARRLNVRPRQVEVWFQNRRARTKLKQTEVDYEFLKKCCATLTDENRKLYKELQELK-A 202
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.3E-18100171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-16105168IPR009057Homeodomain-like
PROSITE profilePS5007116.698110170IPR001356Homeobox domain
SMARTSM003899.6E-14112174IPR001356Homeobox domain
CDDcd000866.09E-15114171No hitNo description
PfamPF000462.4E-15114168IPR001356Homeobox domain
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PfamPF021834.1E-9170204IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.3E-22170213IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGSTCDDICD SAGLDLGLGF SSTSNQKSRK QGQAAAIKFD LGLNLSLPGD NQIYDLKTEN  60
KRNFPSYNKD QLSAASSYSY TSVKRERDIG SDVTEVERVI SSDCYEDDNG SNGRKKLRLT  120
KVQSALLEES FKQQSTLNPK QKQHLARRLN VRPRQVEVWF QNRRARTKLK QTEVDYEFLK  180
KCCATLTDEN RKLYKELQEL KALKIGQPLY MQLPAAAILN VCPSCERVAA AGTFTNPSAA  240
C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016558846.11e-179PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-70HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLM1ANY11e-126M1ANY1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000269681e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-71HD-ZIP family protein